Skip to main content

Github Mirror by Narabot

A collection of github projects and software automatically acquired by Narabot.

PART OF
The Vintage Software Collection
More right-solid
More right-solid
More right-solid
SHOW DETAILS
up-solid down-solid
eye
Title
Date Archived
Creator
Github Mirror by Narabot
software
eye 2,351
favorite 3
comment 0
A curated list of Artificial Intelligence (AI) courses, books, video lectures and papers Awesome Artificial Intelligence (AI) A curated list of Artificial Intelligence (AI) courses, books, video lectures and papers. Contributions most welcome. Contents Courses Books Programming Philosophy Free Content Code Videos Learning Organizations Journals Competitions Movies Misc Courses MIT Artifical Intelligence Videos - MIT AI Course Intro to Artificial Intelligence - Learn the Fundamentals of AI....
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 1,817
favorite 0
comment 0
None ChaturbateRecorder This is script to automate the recording of public webcam shows from chaturbate.com. I have tested this on debian(7+8), ubuntu 14, freenas10 (inside a jail), and Mac OS X (10.10.4), but it should run on other OSsI do not have a windows machine to test on, but I had another user test it on windows and has reported the 6/21/17 update as working on windows 10 using python3.6.2 (may also work on python3.5+) Requirements Requires python3.5 or newer. You can grab python3.5.2...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 1,500
favorite 0
comment 0
Download the bundle reverse-shell-routersploit_-_2017-05-16_10-34-38.bundle and run: git clone reverse-shell-routersploit_-_2017-05-16_10-34-38.bundle -b master The Router Exploitation Framework RouterSploit - Router Exploitation Framework The RouterSploit Framework is an open-source exploitation framework dedicated to embedded devices. It consists of various modules that aids penetration testing operations: exploits - modules that take advantage of identified vulnerabilities creds - modules...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 1,429
favorite 0
comment 0
The classic email sending library for PHP PHPMailer - A full-featured email creation and transfer class for PHP Build status: Class Features Probably the world's most popular code for sending email from PHP! Used by many open-source projects: WordPress, Drupal, 1CRM, SugarCRM, Yii, Joomla! and many more Integrated SMTP support - send without a local mail server Send emails with multiple TOs, CCs, BCCs and REPLY-TOs Multipart/alternative emails for mail clients that do not read HTML email...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 1,297
favorite 0
comment 0
A curated list of awesome AutoHotkey libraries, library distributions, scripts, tools and resources. Awesome AutoHotkey A curated list of awesome AutoHotkey libraries, library distributions, scripts, tools and resources. Inspired by the other awesome lists . Please read CONTRIBUTING.md before contributing. Out-of-date or discontinued, but nonetheless historically relevant items can be found on Historical.md Development state: * Awesome AutoHotkey * Libraries * Clipboard * Console * Data format...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 1,182
favorite 1
comment 0
A collection of hacking / penetration testing resources to make you better! Awesome Hacking Resources A collection of hacking / penetration testing resources to make you better! Let's make it the biggest resource repository for our community. You are welcome to fork and contribute . We started a new tools list, come and contribute Table of Contents Learning the Skills YouTube Channels Companies Conferences NEWS Sharpening Your Skills Reverse Engineering, Buffer Overflow and Exploit Development...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 1,109
favorite 1
comment 0
Download the bundle zbetcheckin-Security_list_-_2017-05-03_22-27-53.bundle and run: git clone zbetcheckin-Security_list_-_2017-05-03_22-27-53.bundle -b master Great security list for fun and profit Security list for fun and profit My initial idea came from this list : http://www.nothink.org/utilities.php I wanted to update it with my sources, I will probably continue to update and reorganize it in the future. Table of Contents Awesome lists Books Bug bounty Cheat sheets CTF...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 1,012
favorite 0
comment 0
Metasploitable3 is a VM that is built from the ground up with a large amount of security vulnerabilities. Metasploitable3 Metasploitable3 is a VM that is built from the ground up with a large amount of security vulnerabilities. It is intended to be used as a target for testing exploits with metasploit . Metasploitable3 is released under a BSD-style license. See COPYING for more details. Building Metasploitable 3 System Requirements:* OS capable of running all of the required applications listed...
Topics: GitHub, code, software, git
Github Mirror by Narabot
by CMU-Perceptual-Computing-Lab
software
eye 999
favorite 0
comment 0
OpenPose: A Real-Time Multi-Person Keypoint Detection And Multi-Threading C++ Library OpenPose Introduction OpenPose is a library for real-time multi-person keypoint detection and multi-threading written in C++ using OpenCV and Caffe*, authored by Gines Hidalgo , Zhe Cao , Tomas Simon , Shih-En Wei , Hanbyul Joo and Yaser Sheikh . It uses Caffe, but the code is ready to be ported to other frameworks (e.g., Tensorflow or Torch). If you implement any of those, please, make a pull request and we...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 975
favorite 0
comment 0
Download the bundle thtrieu-darkflow_-_2017-05-22_23-18-20.bundle and run: git clone thtrieu-darkflow_-_2017-05-22_23-18-20.bundle -b master Translate darknet to tensorflow. Load trained weights, retrain/fine-tune using tensorflow, export constant graph def to mobile devices Intro Real-time object detection and classification. Paper: version 1 , version 2 . Read more about YOLO (in darknet) and download weight files here . In case the weight file cannot be found, I uploaded some of mine here ,...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 895
favorite 0
comment 0
Mask R-CNN for object detection and instance segmentation on Keras and TensorFlow Mask R-CNN for Object Detection and Segmentation This is an implementation of Mask R-CNN on Python 3, Keras, and TensorFlow. The model generates bounding boxes and segmentation masks for each instance of an object in the image. It's based on Feature Pyramid Network (FPN) and a ResNet101 backbone. The repository includes:* Source code of Mask R-CNN built on FPN and ResNet101.* Training code for MS COCO* Pre-trained...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 862
favorite 0
comment 0
TensorFlow - A curated list of dedicated resources http://tensorflow.org Awesome TensorFlow A curated list of awesome TensorFlow experiments, libraries, and projects. Inspired by awesome-machine-learning. What is TensorFlow? TensorFlow is an open source software library for numerical computation using data flow graphs. In other words, the best way to build deep learning models. More info here . Table of Contents - Tutorials - Models/Projects - Powered by TensorFlow - Libraries - Videos - Papers...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 819
favorite 2
comment 0
A collection of awesome software, libraries, documents, books, resources and cools stuffs about security. Awesome Security A collection of awesome software, libraries, documents, books, resources and cool stuff about security. Inspired by awesome-php , awesome-python . Thanks to all contributors , you're awesome and wouldn't be possible without you! The goal is to build a categorized community-driven collection of very well-known resources. Awesome Security Network Scanning / Pentesting...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 803
favorite 0
comment 0
Download the bundle MaximAbramchuck-awesome-interview-questions_-_2017-05-02_13-20-06.bundle and run: git clone MaximAbramchuck-awesome-interview-questions_-_2017-05-02_13-20-06.bundle -b master :octocat: A curated awesome list of lists of interview questions. Feel free to contribute! :mortar_board: Awesome Interviews A curated list of lists of technical interview questions. What makes for an awesome list? Please read the contribution guidelines or the creating a list guide if you want to...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 801
favorite 0
comment 0
Download the bundle alecmuffett-onion-sites-that-dont-suck_-_2017-03-21_20-25-38.bundle and run: git clone alecmuffett-onion-sites-that-dont-suck_-_2017-03-21_20-25-38.bundle -b master Onion Sites That Don't Suck Onion Sites That Don't Suck An index of the non-dark web... updated: see the change history for specifics licensed: cc-by-sa author/editor: alec muffett The Theme This list is for substantial, commercial-or-social-good mainstream websites with onion presence. no nudity, exploitation,...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 793
favorite 0
comment 0
A curated list of awesome social engineering resources. Awesome Social Engineering A curated list of awesome social engineering resources, inspired by the awesome-* trend on GitHub. Those resources and tools are intended only for cybersecurity professional, penetration testers and educational use in a controlled environment. No humans were manipulated to make this list. Table of Contents Online Courses Capture the Flag Psychology Resources Social Engineering Books OSINT Documentation Tools...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 789
favorite 0
comment 0
S3 bucket enumerator slurp Enumerates S3 buckets manually or via certstream Overview First of all, credit to https://github.com/eth0izzle/bucket-stream for the certstream idea Also, credit to all the vendor packages that made this tool possible Not responsible for how you use this tool. Features Written in Go: It's faster than python No dependency hell and version locks (ie python 3 and requirements.txt, etc) Better concurrency Punycode support for internationalized domains (S3 doesn't allow...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 783
favorite 0
comment 0
:computer: An awesome & curated list of best applications and tools for Windows. An awesome & curated list of best applications and tools for Windows. This Awesome Repository is highly inspired from ichait's Awesome osx. Special thanks to egeerardyn . Items marked with are open-source software. Items marked with are free. Applications Audio Chat Clients Compression Customization Data Recovery Developer Tools Documents E-Book Utilities Email Games Graphics Online Storage Productivity...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 781
favorite 0
comment 0
Deep Learning model to analyze a large corpus of clear text passwords. 1.4 Billion Text Credentials Analysis (NLP) Using deep learning and NLP to analyze a large corpus of clear text passwords. Objectives:- Train a generative model.- Understand how people change their passwords over time: hello123 -> h@llo123 -> h@llo!23. Disclaimer: for research purposes only. In the press 1.4 Billion Clear Text Credentials Discovered in a Single Database Collection of 1.4 Billion Plain-Text Leaked...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 780
favorite 0
comment 0
Densely Connected Convolutional Networks, In CVPR 2017 (oral presentation). Densely Connected Convolutional Networks (DenseNets) This repository contains the code for DenseNet introduced in the paper "Densely Connected Convolutional Networks" (CVPR 2017, Best Paper Award) by Gao Huang *, Zhuang Liu *, Laurens van der Maaten and Kilian Weinberger (* Authors contributed equally). Now with much more memory efficient implementation! Please check the technical report and code for more...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 744
favorite 2
comment 0
Curated list of cute girls on Instagram or Facebook in Thailand Awesome Thai Girls credit : giphy A curated list of awesome Thai girls Instagram, Facebook, and other resources.This list is based on personal taste only. Your contributions are always welcome,we are on Github ! Inspired by the awesome list.Using template from awesome-aws ,Jekyll template from awesome-mysql andEmoji from twemoji-awesome . The Fiery Meter of How Popular Instagram with 100k+ followers - :fire: Instagram with 1M+...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 734
favorite 0
comment 0
Automatic License Plate Recognition library openalpr OpenALPR is an open source Automatic License Plate Recognition library written in C++ with bindings in C#, Java, Node.js, Go, and Python. The library analyzes images and video streams to identify license plates. The output is the text representation of any license plate characters. Check out a live online demo here: http://www.openalpr.com/demo-image.html User Guide OpenALPR includes a command line utility. Simply typing "alpr [image...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 719
favorite 0
comment 0
A book about functional programming in JavaScript. Functional-Light JavaScript (book) This book explores the core principles of functional programming (FP) as they are applied to JavaScript. But what makes this book different is that we approach these principles without drowning in all the heavy terminology. We look at a subset of FP foundational concepts that I call "Functional-Light Programming" (FLP) and apply it to JavaScript. Note: Despite the word "Light" in the title,...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 694
favorite 2
comment 0
:computer: An awesome & curated list of best applications and tools for Windows. An awesome & curated list of best applications and tools for Windows. This Awesome Repository is highly inspired from ichait's Awesome osx. Special thanks to egeerardyn . Items marked with are open-source software. Items marked with are free. Applications Audio Chat Clients Compression Customization Data Recovery Developer Tools Documents E-Book Utilities Email Games Graphics Online Storage Productivity...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 693
favorite 0
comment 0
Open Source Point of Sale is a web based point of sale system written in the PHP language. It uses MySQL as the data storage back-end and has a simple user interface. Introduction Open Source Point of Sale is a web based point of sale system.The main features are:* Stock management (Items and Kits)* Sale register with transactions logging* Receipt and invoice printing and/or emailing* Barcode generation and printing* Suppliers and Customers database* Multiuser with permission control*...
Topics: GitHub, code, software, git
Github Mirror by Narabot
by activerecord-hackery
software
eye 631
favorite 0
comment 0
Download the bundle activerecord-hackery-ransack_-_2017-05-21_13-41-38.bundle and run: git clone activerecord-hackery-ransack_-_2017-05-21_13-41-38.bundle -b master Object-based searching. Ransack [ ](https://travis-ci.org/activerecord-hackery/ransack)[ ](http://badge.fury.io/rb/ransack)[ ](https://codeclimate.com/github/activerecord-hackery/ransack) Ransack is a rewrite of MetaSearch created by Ernie Miller and developed/maintained for years by Jon Atack and Ryan Bigg with the help of a great...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 621
favorite 0
comment 0
A Tool for Domain Flyovers AQUATONE AQUATONE is a set of tools for performing reconnaissance on domain names. It candiscover subdomains on a given domain by using open sources as well as the morecommon subdomain dictionary brute force approach. After subdomain discovery,AQUATONE can then scan the hosts for common web ports and HTTP headers, HTMLbodies and screenshots can be gathered and consolidated into a report for easyanalysis of the attack surface. Installation Dependencies AQUATONE depends...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 615
favorite 0
comment 0
:a: collection of awesome resources for the A-Frame WebVR framework. awesome-aframe A collection of awesome resources for the A-Frame WebVRframework. This list is synced now and then. For some of the more recent stuff, check outthe recent A Week of A-Frame roundups on the A-Frame blog . Table of Contents Official Resources Community Learning Components Integration Scenes Tools Official Resources Straight from the horse's mouth. Official Site Documentation and Guides Blog Examples Inspector...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 605
favorite 0
comment 0
Custom firmware for the HackRF SDR + PortaPack H1 addon HAVOC is a fork of the PortaPack H1 firmware, a portability add-on for the HackRF One software-defined radio . Hardware is available at ShareBrained Technology . It is build on top of ShareBrained's firmware , meaning that the original functionalities are kept (except when I don't sync for 2 months). Documentation READ THE WIKI If you want to submit a bug report, suggest something... Don't hesitate, use this page:...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 592
favorite 0
comment 0
Download the bundle 4pr0n-ripme_-_2017-05-24_22-45-06.bundle and run: git clone 4pr0n-ripme_-_2017-05-24_22-45-06.bundle -b master Downloads albums in bulk RipMe Album ripper for various websites. Runs on your computer. Requires Java 1.6 Downloads Download ripme.jar from the latest release . Note: If you're currently using version 1.2.x or 1.3.x, you will not automatically get updates to the newest versions. We recommend downloading the latest version from the link above. For information about...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 585
favorite 0
comment 0
None Swipe-Button Library of an android button activated by swipe. Easy to use. Make your app look great Better UX in sensitive button Instalation compile 'com.ebanx:swipe-button:0.2.1' How to use Add the button in your layout file and customize it the way you like it. Setting the sliding button size You can set the size of the moving part of the button by changing the icon inside it or changing the padding in the button. Setting the text part size You can set the size of the fixed part of the...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 576
favorite 0
comment 0
:memo: Подборка ресурсов по машинному обучению Машинное обучение Постоянно обновляемая подборка ресурсов по машинному обучению. Оглавление Библиотека ML-специалиста + выбор редакции: Дополнительные материалы к курсу «Введение в машинное обучение» Рекомендации от...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 556
favorite 0
comment 0
A curated list of CTF frameworks, libraries, resources and softwares Awesome CTF A curated list of Capture The Flag (CTF) frameworks, libraries, resources, softwares and tutorials. This list aims to help starters as well as seasoned CTF players to find everything related to CTFs at one place. Contributing Please take a quick look at the contribution guidelines first. If you know a tool that isn't present here, feel free to open a pull request. Why? It takes time to build up collection of tools...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 544
favorite 0
comment 0
Download the bundle sbilly-awesome-security_-_2017-04-20_00-01-06.bundle and run: git clone sbilly-awesome-security_-_2017-04-20_00-01-06.bundle -b master A collection of awesome software, libraries, documents, books, resources and cools stuffs about security. Awesome Security A collection of awesome software, libraries, documents, books, resources and cool stuff about security. Inspired by awesome-php , awesome-python . Thanks to all contributors , you're awesome and wouldn't be possible...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 538
favorite 0
comment 0
A curated list of tools for incident response awesome-incident-response A curated list of tools and resources for security incident response, aimed to help security analysts and DFIR teams. Contents All in one tools Books Communities Disk Image Creation Tools Evidence Collection Incident Management Linux Distributions Linux Evidence Collection Log Analysis Tools Memory Analysis Tools Memory Imaging Tools OSX Evidence Collection Other tools Playbooks Process Dump Tools Sandboxing/reversing tools...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 532
favorite 0
comment 0
TXT and PDF documents from the NSA NSA Documents with OCR text version Here is the complete list of PDF documents included 01302014-dagbladet-cop15 interception document.pdf 01312014-cbc-csec airport wifi_tracking.pdf 2009-OIG Report on Bulk Collection.pdf 2011-OIG Report on Bulk Collection.pdf 20130605-guard-verizon 215 secondary_order.pdf 20130606-wapo-prism.pdf 20130608-guard-boundless informant capabilities-(1).pdf 20130608-guard-boundless informant faq.pdf 20130608-guard-prism.pdf...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 530
favorite 1
comment 0
A Web Artisan list of categorized OPEN SOURCE PROJECTS built with Laravel PHP Framework. Laravel-Open-Source-Projects A Web Artisan list of categorized OPEN SOURCE PROJECTS built with Laravel PHP Framework. This repository includes a comprehensive and unlimited list of open source projects built with Laravel for Newbies to the framework or for exploration by any web artisan. Enjoy Pushing Codes!!! Features Laravel Packages/Projects[P] Tutorial Projects [T] A | B | C | D | E | F | G | H | I | J...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 523
favorite 0
comment 0
A MNIST-like fashion product database. Benchmark :point_right: Fashion-MNIST Fashion-MNIST is a dataset of Zalando 's article images—consisting of a training set of 60,000 examples and a test set of 10,000 examples. Each example is a 28x28 grayscale image, associated with a label from 10 classes. We intend Fashion-MNIST to serve as a direct drop-in replacement for the original MNIST dataset for benchmarking machine learning algorithms. It shares the same image size and structure of training...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 511
favorite 0
comment 0
:city_sunrise: A collection of links for free stock photography, video and Illustration websites Awesome Stock Resources A curated list of awesome stock photography, video and illustration websites. I try my best to maintain this repository and keep it up-to-date but if you spot a broken link or a resource which isn't listed, please, feel free to make a pull request. Table of Contents Photography CC0-license Custom License / Usage Public Domain Attribution required licenses Unspecified License...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 509
favorite 0
comment 1
New Features Like DDoS and OnJoin Commands QuasarRAT-Edit use build-debug.bat /build-release.bat to use the features Free, Open-Source Remote Administration Tool for Windows Quasar is a fast and light-weight remote administration tool coded in C#. Providing high stability and an easy-to-use user interface, Quasar is the perfect remote administration solution for you. NEW Features TCP network stream (IPv4 & IPv6 support) Fast network serialization (NetSerializer) Compressed (QuickLZ) &...
favoritefavoritefavoritefavoritefavorite ( 1 reviews )
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 508
favorite 1
comment 0
Multi-Speaker Speech Synthesis in TensorFlow Multi-Speaker Tacotron in TensorFlow [[한국어 가이드](./README_ko.md)] TensorFlow implementation of: Deep Voice 2: Multi-Speaker Neural Text-to-Speech Listening while Speaking: Speech Chain by Deep Learning Tacotron: Towards End-to-End Speech Synthesis Samples audios (in Korean) can be found here . Prerequisites Python 3.6+ FFmpeg Tensorflow 1.3 Usage 1. Install prerequisites After preparing Tensorflow , install prerequisites with: pip3 install...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 490
favorite 0
comment 0
A collection of various awesome lists for hackers, pentesters and security researchers Awesome Hacking A collection of awesome lists for hackers, pentesters & security researchers. Your contributions are always welcome ! Awesome Repositories Repository | Description---- | ---- Android Security | Collection of Android security related resources AppSec | Resources for learning about application security Bug Bounty | List of Bug Bounty Programs and write-ups from the Bug Bounty hunters...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 482
favorite 0
comment 0
Download the bundle junyanz-interactive-deep-colorization_-_2017-05-18_18-34-06.bundle and run: git clone junyanz-interactive-deep-colorization_-_2017-05-18_18-34-06.bundle -b master Deep learning software for colorizing black and white images with a few clicks https://richzhang.github.io Interactive Deep Colorization [Project Page] [Paper] [Demo Video] [Seminar Talk] Richard Zhang *, Jun-Yan Zhu *, Phillip Isola , Xinyang Geng , Angela S. Lin, Tianhe Yu, and Alexei A. Efros . Real-Time...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 480
favorite 0
comment 0
Download the bundle evilsocket-bettercap_-_2017-03-12_14-43-44.bundle and run: git clone evilsocket-bettercap_-_2017-03-12_14-43-44.bundle -b master A complete, modular, portable and easily extensible MITM framework. bettercap is a complete, modular, portable and easily extensible MITM tool and framework with every kind of diagnosticand offensive feature you could need in order to perform a man in the middle attack. Before submitting issues, please read the relevant section in the...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 479
favorite 0
comment 0
Red Team Tips as posted by @vysecurity on Twitter Credits The following tips were posted by @vysecurity on Twitter Disclaimer The following information should not be used for malicious purposes or intent Red Team Tips by @vysecurity on Twitter Red Tip #1: Profile your victim and use their user agent to mask your traffic. Alternatively use UA from software such as Outlook. Red tip #2: If the enemy SOC is using proxy logs for analysis. Guess what? It wont log cookies or POST body content as can...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 475
favorite 0
comment 0
:flags: Creative Resources for Developer and Designer :) Awesome Design Awesome Design focuses on collecting high quality resources and tools which can be used by UI/UX designers in daily work. Thanks to the community, the repo keeps being updated continuously from people around the world who provide amazing resources. Don't hesitate to open an issue or create pull request to share your intelligence. What should I do with those resources? People, including developers, designers, scientists and...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 469
favorite 0
comment 0
A curated list of awesome Phalcon libraries and resources Awesome Phalcon A curated list of awesome Phalcon libraries and resources. Inspired by awesome-go . Contributing Please take a quick gander at the contribution guidelines first. Thanks to all contributors ; you rock! Join us on Slack or Discord to chat with other awesome-phalcon maintainers! Contents Awesome Phalcon ACL Application Skeleton Authentication & OAuth CMS & Blogs Command Line Dashboard Debug DI Docs Events Forms i18n...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 463
favorite 0
comment 0
Infinite cycle ViewPager with two-way orientation and interactive effect. InfiniteCycleViewPager Infinite cycle ViewPager with two-way orientation and interactive effect.                           U can check the sample app here . Download You can download a .aar from GitHub's releases page . Or use Gradle: groovycompile 'com.github.devlight:infinitecycleviewpager:1.0.2' Or Maven: groovycom.github.devlightinfinitecycleviewpager1.0.2pom Or Ivy: groovy Android SDK Version...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 462
favorite 0
comment 0
List of Elixir books Awesome Elixir Books Contents Books Starter Books Advanced Books Web Development Resources Books Starter Books Getting Started Free Official Elixir starting guide that will take you through the language foundations. You will also explore how to build projects with Mix and OTP, and it will introduce you to more advanvced techniques suchs as meta-programming. Elixir School Free Elixir-School is an open and community driven effort inspired by Twitter’s Scala School. The...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 441
favorite 0
comment 0
Pragmatic, balanced FP in JavaScript. @FLJSBook on twitter. Functional-Light JavaScript This book is a balanced, pragramtic look at FP in JavaScript. The first edition is now complete. "Functional-Light JavaScript" explores the core principles of functional programming (FP) as they are applied to JavaScript. But what makes this book different is that we approach these principles without drowning in all the heavy terminology. We look at a subset of FP foundational concepts that I call...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 432
favorite 0
comment 0
One of the hardest Android APIs made into a high level and easy to use library that solves all of your problems. Originally a fork of Google's CameraView library . CameraKit is an extraordinarily easy to use utility to work with the infamous Android Camera and Camera2 APIs. Built by Dylan McIntyre . Try out all the unique features using the CameraKit Demo from the Google Play store! Table of Contents Features Setup Usage Capturing Images Capturing Video Extra Attributes ckFacing ckFlash ckFocus...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 429
favorite 0
comment 0
Automated victim-customized phishing attacks against Wi-Fi clients About Wifiphisher is a security tool that mounts automated victim-customized phishing attacks against WiFi clients in order to obtain credentials or infect the victims with malwares. It is primarily a social engineering attack that unlike other methods it does not include any brute forcing. It is an easy way for obtaining credentials from captive portals and third party login pages (e.g. in social networks) or WPA/WPA2...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 417
favorite 0
comment 0
Download the bundle amitshekhariitbhu-Android-Debug-Database_-_2017-05-23_05-49-31.bundle and run: git clone amitshekhariitbhu-Android-Debug-Database_-_2017-05-23_05-49-31.bundle -b master A library for debugging android databases and shared preferences - Make Debugging Great Again Android Debug Database Android Debug Database is a powerful library for debugging databases and shared preferences in Android applications. Android Debug Database allows you to view databases and shared preferences...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 413
favorite 0
comment 0
None This script tests if APs are affected by CVE-2017-13082 (KRACK attack). See the KRACK attack website for details and also read the research paper . CVE-2017-13082: Key Reinstall in FT Handshake (802.11r) Access Points (APs) might contain a vulnerable implementation of the Fast BSS Transition (FT) handshake. More precisely, a retransmitted or replayed FT Reassociation Request may trick the AP into reinstalling the pairwise key. If the AP does not process retransmitted FT reassociation...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 408
favorite 0
comment 0
MS17-010 Files BUG.txt MS17-010 bug detail and some analysis eternalblue_exploit7.py Eternalblue exploit for windows 7/2008 eternalblue_exploit8.py Eternalblue exploit for windows 8/2012 x64 eternalblue_poc.py Eternalblue PoC for buffer overflow bug eternalblue kshellcode x64.asm x64 kernel shellcode for my Eternalblue exploit. This shellcode should work on Windows Vista (maybe XP) and later eternalblue kshellcode x86.asm x86 kernel shellcode for my Eternalblue exploit. This shellcode should...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 407
favorite 0
comment 0
🚗 A curated list of resources for learning about vehicle security and car hacking Awesome Vehicle Security A curated list of awesome resources, books, hardware, software, applications, people to follow, and more cool stuff about vehicle security, car hacking, and tinkering with the functionality of your car. I would love as much help as I can get. Start contributing! Follow me on Twitter for more security goodness. Legend :- 🌟: MOST AWESOME.- 💰: Costs money. 😞 Contents Learn...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 396
favorite 0
comment 0
List of Machine Learning, AI, NLP solutions for iOS. The most recent version of this article can be found on my blog. Machine Learning for iOS Last Update: June 17, 2017. Curated list of resources for iOS developers in following topics: Core ML Machine Learning Libraries Deep Learning Libraries Deep Learning: Model Compression Computer Vision Natural Language Processing Speech Recognition (TTS) and Generation (STT) Text Recognition (OCR) Other AI Machine Learning Web APIs Opensource ML...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 390
favorite 0
comment 0
Android Remote Administration Tool AhMyth Android Rat Beta Version It consists of two parts :* Server side : desktop application based on electron framework (control panel)* Client side : android application (backdoor) Getting Started You have two options to install it 1) From source code Prerequisite : Electron (to start the app) Java (to generate apk backdoor) Electron-builder and electron-packer (to build binaries for (OSX,WINDOWS,LINUX)) git clone...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 389
favorite 0
comment 0
:octocat: ⭕️ CircleMenu is a simple, elegant UI menu with a circular layout and material design animations. Made by @Ramotion CircleMenu for Android Check this library on other platforms: Looking for developers for your project? The Android mockup available here . Requirements ​- Android 4.4 KitKat (API lvl 19) or greater- Your favorite IDE Installation ​Just download the package from here and add it to your project classpath, or just use the maven repo: Gradle: groovycompile...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 384
favorite 0
comment 0
SmileyRating is a simple rating bar for android. It displays animated smileys as rating icon. Smiley Rating SmileyRating is a simple rating bar for android. It displays animated smileys as rating icon. - Drawn completely using android canvas - Inspired by Bill Labus Demo Integration Integrating SmileyRating in your project is very simple. Step 1: Add this dependency in your project's build.gradle file which is in your app folder groovycompile 'com.github.sujithkanna:smileyrating:1.6.6' add this...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 383
favorite 0
comment 0
A Select control built with and for React JS React-Select A Select control built with and for React . Initially built for use in KeystoneJS . Demo & Examples Live demo: jedwatson.github.io/react-select Installation The easiest way to use react-select is to install it from npm and build it into your app with Webpack. jsyarn add react-select You can then import react-select and its styles in your application as follows: jsimport Select from 'react-select';import...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 383
favorite 0
comment 0
Sentence embeddings (InferSent) and training code for NLI. InferSent InferSent is a sentence embeddings method that provides semantic sentence representations. It is trained on natural language inference data and generalizes well to many different tasks. We provide our pre-trained sentence encoder for reproducing the results from our paper . See also SentEval for automatic evaluation of the quality of sentence embeddings. Dependencies This code is written in python. The dependencies are: Python...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 377
favorite 0
comment 0
Your Cheat Sheet For Android Interview - Android Interview Questions Android Interview Questions Android Interview Questions - Your Cheat Sheet For Android Interview We will be adding answers to the more questions on our Mindorks website . Contents Data Structures And Algorithms Core Java Core Android Architecture Design Problem Tools And Technologies Android Test Driven Development Others Data Structures And Algorithms The level of questions asked on Data Structures And Algorithms totally...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 376
favorite 1
comment 0
A curated list of awesome Raspberry Pi tools, projects, images and resources Awesome Raspberry Pi The Raspberry Pi is a series of credit card-sized single-board computers developed in the United Kingdom by the Raspberry Pi Foundation to promote the teaching of basic computer science in schools and developing countries. Official Link: Raspberry Pi Homepage This list is a collection of tools, projects, images and resources conforming to the Awesome Manifesto Contributions very welcome but first...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 369
favorite 0
comment 0
🏁 High performance subscription-based form state management for React 🏁 React Final Form ✅ Zero dependencies ✅ Only peer dependencies: React and 🏁 Final Form ✅ Opt-in subscriptions - only update on the state you need! ✅ 💥 2.2k gzipped 💥 Installation bashnpm install --save react-final-form final-form or bashyarn add react-final-form final-form Getting Started 🏁 React Final Form is a thin React wrapper for 🏁 Final Form, which is asubscriptions-based form state...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 368
favorite 0
comment 0
an awesome list of honeypot resources Awesome Honeypots A curated list of awesome honeypots, tools, components and much more. The list is divided into categories such as web, services, and others, focusing on open source projects. There is no pre-established order of items in each category, the order is for contribution. If you want to contribute, please read the guide . Discover more awesome lists at sindresorhus/awesome . Sections Honeypots Honeyd Tools Network and Artifact Analysis Data...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 363
favorite 0
comment 0
Papers about deep learning ordered by task, date. Current state-of-the-art papers are labelled. Deep Learning Papers by task Papers about deep learning ordered by task, date. Current state-of-the-art papers and papers useful for getting started are labelled. For each paper there is a permanent link, which is either to Arxiv.org or to a copy of the original paper in this repository. Table of Contents Text 1.1. Code Generation 1.2. Sentiment Analysis 1.3. Translation 1.4. Summarization 1.5....
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 358
favorite 0
comment 0
A powerful Android chart view / graph view library, supporting line- bar- pie- radar- bubble- and candlestick charts as well as scaling, dragging and animations. Remember: It's all about the looks. MPAndroidChart :zap: is a powerful & easy to use chart library for Android. It runs on API level 8 and upwards. As an additional feature, this library allows cross-platform development between Android and iOS as an iOS version of this library is also available: Charts :zap: Are you using this...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 352
favorite 0
comment 0
:mortar_board: Path to a free self-taught education in Computer Science! Open Source Society University Path to a self-taught education in Computer Science! Contents Summary Curriculum Prerequisites Introduction to Computer Science Core CS Advanced CS Final project Pro CS Community How to show your progress Team References Summary The OSSU curriculum is a complete education in computer science using online materials.It's not merely for career training or professional development.It's for those...
Topics: GitHub, code, software, git
Github Mirror by Narabot
by robertdavidgraham
software
eye 348
favorite 0
comment 0
TCP port scanner, spews SYN packets asynchronously, scanning entire Internet in under 5 minutes. MASSCAN: Mass IP port scanner This is the fastest Internet port scanner. It can scan the entire Internetin under 6 minutes, transmitting 10 million packets per second. It produces results similar to nmap , the most famous port scanner.Internally, it operates more like scanrand , unicornscan , and ZMap , usingasynchronous transmission. The major difference is that it's faster than theseother...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 341
favorite 0
comment 0
Download an entire website from the Wayback Machine. Wayback Machine Downloader Download an entire website from the Internet Archive Wayback Machine. Installation You need to install Ruby on your system (>= 1.9.2) - if you don't already have it.Then run: gem install wayback_machine_downloader Tip: If you run into permission errors, you might have to add sudo in front of this command. Basic Usage Run wayback machine downloader with the base url of the website you want to retrieve as a...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 340
favorite 1
comment 0
A list of awesome Robotics resources Awesome Robotics This is a list of various books, courses and other resources for robotics. It's an attempt to gather useful material in one place for everybody who wants to learn more about the field. Courses Artificial Intelligence for Robotics Udacity Robotics Nanodegree Udacity :dollar: Autonomous Mobile Robots edX Underactuated Robotics edX Autonomous Mobile Robots edX Robot Mechanics and Control, Part I edX Robot Mechanics and Control, Part II edX...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 337
favorite 1
comment 0
:link: Some useful websites for programmers. Best-websites-a-programmer-should-visit Some useful websites for programmers. When learning CS there are some useful sites you must know to get always informed in order to do your technologies eve and learn new things. Here is a non exhaustive list of some sites you should visit, this list will get updated as soon as I can get another link, but you can also contribute by adding those you know :wink: When you get stuck Stack Overflow : subscribe to...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 317
favorite 0
comment 0
Render After Effects animations natively on Android and iOS Lottie for Android, iOS , and React Native Lottie is a mobile library for Android and iOS that parses Adobe After Effects animations exported as json with Bodymovin and renders them natively on mobile! For the first time, designers can create and ship beautiful animations without an engineer painstakingly recreating it by hand. They say a picture is worth 1,000 words so here are 13,000: All of these animations were created in After...
Topics: GitHub, code, software, git
Github Mirror by Narabot
software
eye 314
favorite 0
comment 0
SecLists is the security tester's companion. It is a collection of multiple types of lists used during security assessments. List types include usernames, passwords, URLs, sensitive data grep strings, fuzzing payloads, and many more. About SecLists is the security tester's companion. It's a collection of multiple types of lists used during security assessments, collected in one place. List types include usernames, passwords, URLs, sensitive data patterns, fuzzing payloads, web shells, and many...
Topics: GitHub, code, software, git